PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.23810s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 367aa    MW: 41429.4 Da    PI: 6.9393
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.23810s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.42.4e-31184238155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k+r+rWt++LHe+Fve+v+++GG++kAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Araha.23810s0002.1.p 184 KTRIRWTQDLHEKFVECVNRIGGADKATPKAILKLMDSDGLTIFHVKSHLQKYRI 238
                           68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.13181241IPR017930Myb domain
SuperFamilySSF466892.51E-17181238IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-28183239IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-23184239IPR006447Myb domain, plants
PfamPF002496.6E-8188237IPR001005SANT/Myb domain
PfamPF143797.7E-21268315IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MDNINFEFSN ASQGSRLQSQ PFNLQDLNMI QYNQPSSPWT TESFSGLSPY DCTANQSFPV  60
QCSSSKPYPS SFHPYHHQSS DPPSLDQSVS MLPMQPLPDQ YLKPLYQRSC ANDFAATNAS  120
SASYSLSFEA NHDPQELCRR IYSSSNVTHL NFSSSRPKQN HPRYSSPPSF STHGGSVAPN  180
CVNKTRIRWT QDLHEKFVEC VNRIGGADKA TPKAILKLMD SDGLTIFHVK SHLQKYRIAK  240
YMPESQEGKF EKRACAKELS QLDTRTGVQI KEALQLQLDV QRHLHEQLEI QRNLQLRIEE  300
QGKQLKMMME QQQKTKESLL KPPDSTEASL CLLASDDSPP SPFLVQDTEA LMLTSYEDTQ  360
LQSKIS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2266440.0AK226644.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL07-39-G11.
GenBankBT0126580.0BT012658.1 Arabidopsis thaliana At5g06800 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002871230.10.0hypothetical protein ARALYDRAFT_487493
TrEMBLD7LZU10.0D7LZU1_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.6__627__AT5G06800.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54762748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.10.0G2-like family protein